Sign In | Join Free | My chinacomputerparts.com
chinacomputerparts.com
Products
Search by Category
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
Submit Buying Request

noise reduction foam

All noise reduction foam wholesalers & noise reduction foam manufacturers come from members. We doesn't provide noise reduction foam products or service, please contact them directly and verify their companies info carefully.

Total 8537 products from noise reduction foam Manufactures & Suppliers
China Noise Reduction Foamed Rubber Sheet Insulation Boards 1000mm 1200mm factory

Brand Name:HaiKe

Model Number:HK95020

Place of Origin:Chongqing China

Recommend Insulation Boards Heat Resistant Noise Reduction Foamed Rubber High Density Office Building Plastic Product Paramenters Thermal Conductivity ≤0.034w/(m.k) Length 7-30m, or customized Density ...

Chongqing Haike Thermal Insulation Material Co., Ltd.
Active Member

Chongqing

China Interior Acoustic Foam Wall Panels Decorative Fiber Glass Noise Reduction Foam Panels factory

Place of Origin:guangzhou

Brand Name:JFZ

Product Details Using a combination of various inorganic materials, with inorganic materials as the main material, a special board is made by adding conductive materials such as conductive porcelain clay powder and conductive mica powder, reinforcing ...

Guangzhou Jiansheng Acoustics Decoration Engineering Co., Ltd.
Verified Supplier

China Rogers L-32 Foam Waterproof Flame Retardant Noise Reduction Polyurethane Foam factory

Brand Name:Rogers

Model Number:L-32

Place of Origin:China

...dustproof sealing, shock absorption resistance and noise reduction. Suitable for electronic products, automotive parts, precision industrial equipment waterproof and dustproof, sealing, cushioning and shock-proof, shading, etc. Product ...

SZ PUFENG PACKING MATERIAL LIMITED
Verified Supplier

Guangdong

China Durable Silicone Foam Gasket With High Compression And Creep Resistance Ideal For Cushioning And Noise Reduction Applications factory

Model Number:Z-Foam800-10SEC

Brand Name:Ziitek

Place of Origin:China

...formed by the foaming of polysiloxane, retaining the excellent properties of silicone polymers, such as resistance to high and low temperatures, ultraviolet light, ozone, weatherability, insulation, and ...

Dongguan Ziitek Electronical Material and Technology Co., Ltd
Verified Supplier

Guangdong

China Safety Reusable Silicone Earplugs 31.5*12.5mm with 32dB SNR Noise Reduction and Washable Design factory

Brand Name:Futuretech

Model Number:FTFE-04

Place of Origin:Shenzhen

... Silicone Foam Ear Plugs 31.5 X 12.5mm With Nylon PVC Cord Product Overview Safety silicone earplugs with nylon or PVC cord for superior ear protection in various environments. Key Features Perfect Noise Reduction Provides maximum noise reduction (NRR 25dB...

FUTURE TECH LIMITED
Verified Supplier

China 33kg/M3 2mm Laminate Underlay 200sqft/Roll Floor Impact Noise Reduction Underlayment factory

Brand Name:new top star

Model Number:IXPE3030-4

Place of Origin:china

...Foam Underlay 200sqft/roll Noise Reduction Underlayment The Green IXPE foam flooring underlayment is 2mm thick and will provide you with the best performance of moisture barrier protection AND sound reduction to keep your floors free of squeaks! The 40microns membrane will protect your floors from moisture rising from your subfloor. 3 in 1 IXPE foam...

Changzhou New Top Star New Material Technology Co.,Ltd
Verified Supplier

China EVA Floor Soundproof Film | Noise Reduction Flooring Underlayment Supplier factory

Model Number:SR

Brand Name:SR

Place of Origin:CHINA

... comfort, and provide moisture protection for various flooring systems. Manufactured from premium Ethylene Vinyl Acetate (EVA) foam, this flooring underlay offers excellent elasticity, shock absorption, sound insulation, and durability. This product is

Changzhou Sponge & Rubber Products Co., Ltd
Verified Supplier

Jiangsu

China 3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction factory

Brand Name:CYG

Model Number:4012

Place of Origin:China

3 - 12mm Thickness Fire Retardant Insulation Foam Acoustic Noise Reduction Irradiated cross-linked polyethylene foam (IXPE foam) is very fine celled microcellular foam. IXPE foam is used for medical applications, heart forming, high-end protective ...

Cyg Tefa Co., Ltd.
Verified Supplier

Guangdong

China Blue IXPE 2mm Foam Underlay Noise Reduction Underlay For Wood Floor factory

Brand Name:No Brand

Model Number:30IXPE 20

Place of Origin:China

...IXPE Foam For Wood Floor Comfort Step And Noise Reduction Introduction: IXPE makes great flooring underlayment due to its closed-cell structure and controllable expansion ratio. The lifespan of IXPE is also significantly longer than traditional PE foam. As...

Jiangsu Zhongxinhe New Material Technology Co., Ltd.
Site Member

Jiangsu

China 38dB SNR 31dB NRR Noise Dampening Foam Ear Plugs 12*7*24mm factory

Place of Origin:Zhejiang China

Brand Name:FuXing

Model Number:OEM ODM

...Foam Disposable Earplugs Slow Rebounded Soft Ear Plugs Non-toxic & Slow Rebound Material: Made of Super Soft and Non-toxic PU Foam (Latex free and PVC free); Slow rebound foam material fits different ear canal structures and have no pressure on ear High Noise Reduction: 38dB SNR (Single Number Rating) and 31dB NRR (Noise Reduction Rating) - They are two different rating systems; High noise reduction rate ear plugs can meet the needs of noise

JIAXING FUXING IMP. AND EXP. CO.,LTD
Active Member

Zhejiang

China Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones factory

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Earlisten Electronic Co ., Ltd
Active Member

Guangdong

China Dark Blue Noise Reduction Earbuds , Plastic Foldable On Ear Headphones factory

Brand Name:EARLISTEN

Model Number:HEADPHONE

Place of Origin:CHINA

...watching TV 3. Premium sound quality for superior listening experience 4. Skin-friendly protein leather ear pad with memory foam for comfortable wearing 5. Proximity sensor auto pauses audio when headphones are removed and resumes when they're replaced 6.

Earlisten Electronic Co ., Ltd
Verified Supplier

Guangdong

China Knife Cutting Foam Crusher Machine Low Noise Pu Foam Shredder Machine factory

Place of Origin:Qingdao, China

Brand Name:Xinmei

... noise knife cutting pulverizer This machine is mainly used for crushing sponges, cloth sponges, pea, EVA, plastics and rubber. It can be used with sponge regeneration equipment. Tdp-s-4 crusher is equipped with sound insulation and noise reduction device.

Qingdao Xinmeiteng Sponge Manufacture Co.
Verified Supplier

Shandong

China Wholesale Comfortable Reusable Tapered Foam Ear Plugs Hearing Protection Noise Reduction Banded Earplugs factory

Brand Name:UNIFORM

Model Number:AUTC-HP-M1152

Place of Origin:CHINA

... Function Reduce Harmful Noises Type In-Ear Protection Feature Safetysoftcomfortable Size Standard Size Use Noisy Workingsleepingtravellyingflying Application Noisy Environment Model ...

Anhui Uniform Trading Co.Ltd
Verified Supplier

Anhui

China 77mm Noise Reduction Aluminum Foam Filled Roller Shutter Door with 400KG-2000KG Motor and 60N-300N Motor factory

Categories:Aluminum Roller Shutter Door

Country/Region:china

Noise Reduction Aluminum Foam Filled Roller Shutters Applications 1. commercial shop 2. factory 3. warehouse 4. residential garage 5. club bars Functions safety and security, theftproof, heat insulation, weather resistant, rustproof, sound Insulation Specifications 1, Item name Slat Width 77mm Thickness 0.45 mm Type of slat With polyurethane foam filled Foam...

Starking Shutter Manufacturer Limited
Verified Supplier

China NOISE REDUCTION HEADPHONE #ANC-J3 factory

Place of Origin:China

Model Number:#ANC-J3

... unit, to ensure the highest quality. 3.3.7v lithium ion battery,it was recharged without replacing batteries. 4.two modes of operation, to choose noise reduction state (subject to a battery), the normal state (without battery) ,it was easy to switch. 5

Shenzhen Bowei Electronics Co.,Ltd.
Active Member

Guangdong

China Self Adhesive Rubber Weather Stripping Noise Reduction Epdm Foam Strip factory

Brand Name:JYD

Model Number:custom made

Place of Origin:China

... Rubber Weather Stripping Noise Reduction Epdm Foam Strip Product Description Self Adhesive Rubber Weather Stripping is a convenient and versatile sealing solution designed to block out drafts, moisture, dust, and noise from entering or escaping through...

Sichuan Jiayueda Building Materials Co., Ltd.
Active Member

Sichuan

China Construction Site Safety Soft Ear Plugs Flexible Maximum Noise Reduction factory

Place of Origin:Changzhou, Jiangsu

Brand Name:Good Job

... of ear canal, ensuring a better sealing, maximum noise reduction and optimal hearing protection. Performance Earplug dispenser with earplugs, the earplugs are 100% PVC-Free, slow rebound: various rebound time are welcomed. Our foam earplugs are made of

CHANGZHOU GOOD-JOB INDUSTRY CO., LTD.
Active Member

Jiangsu

China Wireless Bass Bluetooth Headset Active Noise Reduction Headphones For Gaming Phone factory

Brand Name:Aonike

Model Number:BT800

Place of Origin:China

... Noise Reduction Bluetooth Headset for Gaming Phone Bluetooth Foldable Headset HiFi Wireless Headphones Support Radio Stereo Headset With Mic Deep Bass *Product Description Type: Active Noise Cancelling Chipset: TI (Texas Instruments) Noise reduction ...

Shengpai Electronics Co,ltd
Active Member

Guangdong

Inquiry Cart 0